Lineage for d1hlga_ (1hlg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134646Family c.69.1.6: Gastric lipase [53506] (1 protein)
  6. 2134647Protein Gastric lipase [53507] (2 species)
  7. 2134651Species Human (Homo sapiens) [TaxId:9606] [53508] (1 PDB entry)
  8. 2134652Domain d1hlga_: 1hlg A: [34656]
    complexed with nag

Details for d1hlga_

PDB Entry: 1hlg (more details), 3 Å

PDB Description: crystal structure of human gastric lipase
PDB Compounds: (A:) lipase, gastric

SCOPe Domain Sequences for d1hlga_:

Sequence, based on SEQRES records: (download)

>d1hlga_ c.69.1.6 (A:) Gastric lipase {Human (Homo sapiens) [TaxId: 9606]}
spevtmnisqmitywgypneeyevvtedgyilevnripygkknsgntgqrpvvflqhgll
asatnwisnlpnnslafiladagydvwlgnsrgntwarrnlyyspdsvefwafsfdemak
ydlpatidfivkktgqkqlhyvghsqgttigfiafstnpslakriktfyalapvatvkyt
kslinklrfvpqslfkfifgdkifyphnffdqflatevcsremlnllcsnalfiicgfds
knfntsrldvylshnpagtsvqnmfhwtqavksgkfqaydwgspvqnrmhydqsqppyyn
vtamnvpiavwnggkdlladpqdvglllpklpnliyhkeipfynhldfiwamdapqevyn
divsmisedkk

Sequence, based on observed residues (ATOM records): (download)

>d1hlga_ c.69.1.6 (A:) Gastric lipase {Human (Homo sapiens) [TaxId: 9606]}
spevtmnisqmitywgypneeyevvtedgyilevnripygkknsgqrpvvflqhgllasa
tnwisnlpnnslafiladagydvwlgnsrgntwarrnlyyspdsvefwafsfdemakydl
patidfivkktgqkqlhyvghsqgttigfiafstnpslakriktfyalapvatvkytksl
inklrfvpqslfkfifgdkifyphnffdqflatevcsremlnllcsnalfiicgfdsknf
ntsrldvylshnpagtsvqnmfhwtqavksgkfqaydwgspvqnrmhydqsqppyynvta
mnvpiavwnggkdlladpqdvglllpklpnliyhkeipfynhldfiwamdapqevyndiv
smisedkk

SCOPe Domain Coordinates for d1hlga_:

Click to download the PDB-style file with coordinates for d1hlga_.
(The format of our PDB-style files is described here.)

Timeline for d1hlga_: