Lineage for d4mpfa2 (4mpf A:80-244)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322548Protein automated matches [226848] (11 species)
    not a true protein
  7. 2322562Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 3046491Domain d4mpfa2: 4mpf A:80-244 [346553]
    Other proteins in same PDB: d4mpfa1, d4mpfb1, d4mpfb3
    automated match to d2ljra1
    complexed with po4, tla

Details for d4mpfa2

PDB Entry: 4mpf (more details), 2.1 Å

PDB Description: crystal structure of human glutathione transferase theta-2, complex with inorganic phosphate, gsh free, target efi-507257
PDB Compounds: (A:) Glutathione S-transferase theta-2

SCOPe Domain Sequences for d4mpfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpfa2 a.45.1.1 (A:80-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpkekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOPe Domain Coordinates for d4mpfa2:

Click to download the PDB-style file with coordinates for d4mpfa2.
(The format of our PDB-style files is described here.)

Timeline for d4mpfa2:

  • d4mpfa2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-05