Lineage for d1ivyb_ (1ivy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134616Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 protein domains)
    automatically mapped to Pfam PF00450
  6. 2134617Protein Human 'protective protein', HPP [53504] (1 species)
    synonyms: cathepsin A, carboxypeptidase L
  7. 2134618Species Human (Homo sapiens) [TaxId:9606] [53505] (4 PDB entries)
  8. 2134623Domain d1ivyb_: 1ivy B: [34655]
    complexed with nag

Details for d1ivyb_

PDB Entry: 1ivy (more details), 2.2 Å

PDB Description: physiological dimer hpp precursor
PDB Compounds: (B:) human protective protein

SCOPe Domain Sequences for d1ivyb_:

Sequence, based on SEQRES records: (download)

>d1ivyb_ c.69.1.5 (B:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
fltikgaghmvptdkplaaftmfsrflnkqpy

Sequence, based on observed residues (ATOM records): (download)

>d1ivyb_ c.69.1.5 (B:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmdpp
ctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssqky
qillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshiafl
tikgaghmvptdkplaaftmfsrflnkqpy

SCOPe Domain Coordinates for d1ivyb_:

Click to download the PDB-style file with coordinates for d1ivyb_.
(The format of our PDB-style files is described here.)

Timeline for d1ivyb_: