Lineage for d1ivya_ (1ivy A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73744Family c.69.1.5: Serine carboxypeptidase [53499] (2 proteins)
  6. 73745Protein Human 'protective protein', HPP [53504] (1 species)
  7. 73746Species Human (Homo sapiens) [TaxId:9606] [53505] (1 PDB entry)
  8. 73747Domain d1ivya_: 1ivy A: [34654]

Details for d1ivya_

PDB Entry: 1ivy (more details), 2.2 Å

PDB Description: physiological dimer hpp precursor

SCOP Domain Sequences for d1ivya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens)}
apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
fltikgaghmvptdkplaaftmfsrflnkqpy

SCOP Domain Coordinates for d1ivya_:

Click to download the PDB-style file with coordinates for d1ivya_.
(The format of our PDB-style files is described here.)

Timeline for d1ivya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ivyb_