SCOPe 2.08: Domain d1ivya_: 1ivy A:

Lineage for d1ivya_ (1ivy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
   automatically mapped to Pfam PF00450

6. Protein Human 'protective protein', HPP [53504] (1 species)
   synonyms: cathepsin A, carboxypeptidase L

7. Species Human (Homo sapiens) [TaxId:9606] [53505] (6 PDB entries)

8. Domain d1ivya_: 1ivy A: [34654]
   complexed with nag

Details for d1ivya_

PDB Entry: 1ivy, 2.2 Å

PDB Description: physiological dimer hpp precursor

PDB Compounds: (A:) human protective protein

SCOPe Domain Sequences for d1ivya_:

Sequence; same for both SEQRES and ATOM records:

>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]}
apdqdeiqrlpglakqpsfrqysgylkssgskhlhywfvesqkdpenspvvlwlnggpgc
ssldglltehgpflvqpdgvtleynpyswnlianvlylespagvgfsysddkfyatndte
vaqsnfealqdffrlfpeyknnklfltgesyagiyiptlavlvmqdpsmnlqglavgngl
ssyeqndnslvyfayyhgllgnrlwsslqthccsqnkcnfydnkdlecvtnlqevarivg
nsglniynlyapcaggvpshfryekdtvvvqdlgniftrlplkrmwhqallrsgdkvrmd
ppctnttaastylnnpyvrkalnipeqlpqwdmcnflvnlqyrrlyrsmnsqylkllssq
kyqillyngdvdmacnfmgdewfvdslnqkmevqrrpwlvkygdsgeqiagfvkefshia
fltikgaghmvptdkplaaftmfsrflnkqpy

Timeline for d1ivya_:

• d1ivya_ first appeared (with stable ids) in SCOP 1.55
  
• d1ivya_ appears in SCOPe 2.07