![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins) automatically mapped to Pfam PF00450 |
![]() | Protein Serine carboxypeptidase II [53500] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId:4932] [53503] (1 PDB entry) prohormone-processing carboxypeptidase |
![]() | Domain d1ac5a_: 1ac5 A: [34653] complexed with nag |
PDB Entry: 1ac5 (more details), 2.4 Å
SCOPe Domain Sequences for d1ac5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} lpsseeykvayellpglsevpdpsnipqmhaghiplrsedadeqdssdleyffwkftnnd sngnvdrpliiwlnggpgcssmdgalvesgpfrvnsdgklylnegswiskgdllfidqpt gtgfsveqnkdegkidknkfdedledvtkhfmdflenyfkifpedltrkiilsgesyagq yipffanailnhnkfskidgdtydlkalligngwidpntqslsylpfamekklidesnpn fkhltnahencqnlinsastdeaahfsyqecenilnlllsytressqkgtadclnmynfn lkdsypscgmnwpkdisfvskffstpgvidslhldsdkidhwkectnsvgtklsnpiskp sihllpgllesgieivlfngdkdlicnnkgvldtidnlkwggikgfsddavsfdwihksk stddseefsgyvkydrnltfvsvynashmvpfdkslvsrgivdiysndvmiidnngknvm itt
Timeline for d1ac5a_: