Lineage for d1ysca_ (1ysc A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1382828Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
    automatically mapped to Pfam PF00450
  6. 1382840Protein Serine carboxypeptidase II [53500] (3 species)
  7. 1382841Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53502] (2 PDB entries)
  8. 1382843Domain d1ysca_: 1ysc A: [34652]
    complexed with ndg

Details for d1ysca_

PDB Entry: 1ysc (more details), 2.8 Å

PDB Description: 2.8 angstroms structure of yeast serine carboxypeptidase
PDB Compounds: (A:) serine carboxypeptidase

SCOPe Domain Sequences for d1ysca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysca_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
glffelgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
nflelffdqfpeyvnkgqdfhiagesyaghyipvfaseilshkdrnfnltsvligngltd
pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
l

SCOPe Domain Coordinates for d1ysca_:

Click to download the PDB-style file with coordinates for d1ysca_.
(The format of our PDB-style files is described here.)

Timeline for d1ysca_: