Lineage for d1cpya_ (1cpy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900209Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
    automatically mapped to Pfam PF00450
  6. 2900224Protein Serine carboxypeptidase II [53500] (3 species)
  7. 2900225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53502] (2 PDB entries)
  8. 2900226Domain d1cpya_: 1cpy A: [34651]
    complexed with nag

Details for d1cpya_

PDB Entry: 1cpy (more details), 2.6 Å

PDB Description: site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
PDB Compounds: (A:) serine carboxypeptidase

SCOPe Domain Sequences for d1cpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpya_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
glffalgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
nflelffdqfpeyvnkgqdfhiagasyaghyipvfaseilshkdrnfnltsvligngltd
pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
l

SCOPe Domain Coordinates for d1cpya_:

Click to download the PDB-style file with coordinates for d1cpya_.
(The format of our PDB-style files is described here.)

Timeline for d1cpya_: