SCOPe 2.08: Domain d5moib1: 5moi B:338-438

Lineage for d5moib1 (5moi B:338-438)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5moib1: 5moi B:338-438 [346495]
   automated match to d1ls0a5
   complexed with edo, peg, po4

Details for d5moib1

PDB Entry: 5moi, 2.2 Å

PDB Description: crystal structure of human ige-fc epsilon 3-4

PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d5moib1:

Sequence, based on SEQRES records:

>d5moib1 b.1.1.2 (B:338-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrngtl
tvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Sequence, based on observed residues (ATOM records):

>d5moib1 b.1.1.2 (B:338-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aylsrpspfdlfirksptitclvvdtvqltwsrasgkpvqhstrkeekqrtvtstlpvgt
rdwiegetyqcrvtalmrsttktsg

Timeline for d5moib1:

• d5moib1 first appeared in SCOPe 2.07