SCOPe 2.08: Domain d4mpfb2: 4mpf B:80-244

Lineage for d4mpfb2 (4mpf B:80-244)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d4mpfb2: 4mpf B:80-244 [346491]
   Other proteins in same PDB: d4mpfa1, d4mpfb1, d4mpfb3
   automated match to d2ljra1
   complexed with po4, tla

Details for d4mpfb2

PDB Entry: 4mpf, 2.1 Å

PDB Description: crystal structure of human glutathione transferase theta-2, complex with inorganic phosphate, gsh free, target efi-507257

PDB Compounds: (B:) Glutathione S-transferase theta-2

SCOPe Domain Sequences for d4mpfb2:

Sequence; same for both SEQRES and ATOM records:

>d4mpfb2 a.45.1.1 (B:80-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpkekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d4mpfb2:

• d4mpfb2 first appeared in SCOPe 2.07