SCOPe 2.08: Domain d4mpfb1: 4mpf B:1-79

Lineage for d4mpfb1 (4mpf B:1-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d4mpfb1: 4mpf B:1-79 [346490]
   Other proteins in same PDB: d4mpfa2, d4mpfb2, d4mpfb3
   automated match to d2ljra2
   complexed with po4, tla

Details for d4mpfb1

PDB Entry: 4mpf, 2.1 Å

PDB Description: crystal structure of human glutathione transferase theta-2, complex with inorganic phosphate, gsh free, target efi-507257

PDB Compounds: (B:) Glutathione S-transferase theta-2

SCOPe Domain Sequences for d4mpfb1:

Sequence; same for both SEQRES and ATOM records:

>d4mpfb1 c.47.1.0 (B:1-79) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

Timeline for d4mpfb1:

• d4mpfb1 first appeared in SCOPe 2.07