Lineage for d5bk1b_ (5bk1 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522109Species Escherichia coli [TaxId:562] [189978] (3 PDB entries)
  8. 2522111Domain d5bk1b_: 5bk1 B: [346473]
    Other proteins in same PDB: d5bk1d1, d5bk1d2, d5bk1l1, d5bk1l2
    automated match to d1jvya_
    complexed with cl, gol

Details for d5bk1b_

PDB Entry: 5bk1 (more details), 2.15 Å

PDB Description: crystal structure of maltose binding protein in complex with an endosteric synthetic antibody
PDB Compounds: (B:) Maltose binding protein

SCOPe Domain Sequences for d5bk1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk1b_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqt

SCOPe Domain Coordinates for d5bk1b_:

Click to download the PDB-style file with coordinates for d5bk1b_.
(The format of our PDB-style files is described here.)

Timeline for d5bk1b_: