SCOPe 2.06: Domain d1bcs.1: 1bcs A:,B:

Lineage for d1bcs.1 (1bcs A:,B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
   automatically mapped to Pfam PF00450

6. Protein Serine carboxypeptidase II [53500] (3 species)

7. Species Wheat (Triticum vulgare) [TaxId:4565] [53501] (5 PDB entries)

8. Domain d1bcs.1: 1bcs A:,B: [34647]
   complexed with act, arg, gol, nag

Details for d1bcs.1

PDB Entry: 1bcs, 2.08 Å

PDB Description: complex of the wheat serine carboxypeptidase, cpdw-ii, with the microbial peptide aldehyde inhibitor, chymostatin, and arginine at 100 degrees kelvin

PDB Compounds: (A:) serine carboxypeptidase II, (B:) serine carboxypeptidase II

SCOPe Domain Sequences for d1bcs.1:

Sequence; same for both SEQRES and ATOM records:

>g1bcs.1 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat (Triticum vulgare) [TaxId: 4565]}
haadriarlpgqpavdfdmysgyitvdegagrslfyllqeapedaqpaplvlwlnggpgc
ssvaygaseelgafrvkprgaglvlneyrwnkvanvlfldspagvgfsytntssdiytsg
dnrtahdsyaflakwferfphykyrdfyiagesyaghyvpelsqlvhrsknpvinlkgfm
vgngliddyhdyvgtfefwwnhgivsddtyrrlkeaclhdsfihpspacdaatdvataeq
gnidmyslytpvcniXsydpcterystayynrrdvqmalhanvtgamnytwatcsdtint
hwhdaprsmlpiyreliaaglriwvfsgdtdavvpltatrysigalglptttswypwydd
qevggwsqvykgltlvsvrgaghevplhrprqalvlfqyflqgkpmpgq

Timeline for d1bcs.1:

• d1bcs.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bcs.1 appears in SCOPe 2.05
  
• d1bcs.1 appears in SCOPe 2.07
  
• d1bcs.1 appears in the current release, SCOPe 2.08