Lineage for d1bcs.1 (1bcs A:,B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.5: Serine carboxypeptidase [53499] (2 proteins) Protein Serine carboxypeptidase II [53500] (3 species) Species Wheat (Triticum vulgaris) [53501] (5 PDB entries) 
Domain d1bcs.1: 1bcs A:,B: [34647]
Details for d1bcs.1
PDB Entry: 1bcs (more details), 2.1 Å
PDB Description: complex of the wheat serine carboxypeptidase, cpdw-ii, with the microbial peptide aldehyde inhibitor, chymostatin, and arginine at 100 degrees kelvin
SCOP Domain Sequences for d1bcs.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1bcs.1 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat (Triticum vulgaris)}
haadriarlpgqpavdfdmysgyitvdegagrslfyllqeapedaqpaplvlwlnggpgc
ssvaygaseelgafrvkprgaglvlneyrwnkvanvlfldspagvgfsytntssdiytsg
dnrtahdsyaflakwferfphykyrdfyiagesyaghyvpelsqlvhrsknpvinlkgfm
vgngliddyhdyvgtfefwwnhgivsddtyrrlkeaclhdsfihpspacdaatdvataeq
gnidmyslytpvcniXsydpcterystayynrrdvqmalhanvtgamnytwatcsdtint
hwhdaprsmlpiyreliaaglriwvfsgdtdavvpltatrysigalglptttswypwydd
qevggwsqvykgltlvsvrgaghevplhrprqalvlfqyflqgkpmpgq
SCOP Domain Coordinates for d1bcs.1:
Click to download the PDB-style file with coordinates for d1bcs.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bcs.1:
- d1bcs.1 appears in SCOP 1.57
- d1bcs.1 appears in the current release, SCOPe 2.08
View in 3D