Lineage for d1bcs.1 (1bcs A:,B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900209Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
    automatically mapped to Pfam PF00450
  6. 2900224Protein Serine carboxypeptidase II [53500] (3 species)
  7. 2900230Species Wheat (Triticum vulgare) [TaxId:4565] [53501] (5 PDB entries)
  8. 2900233Domain d1bcs.1: 1bcs A:,B: [34647]
    complexed with act, arg, gol, nag

Details for d1bcs.1

PDB Entry: 1bcs (more details), 2.08 Å

PDB Description: complex of the wheat serine carboxypeptidase, cpdw-ii, with the microbial peptide aldehyde inhibitor, chymostatin, and arginine at 100 degrees kelvin
PDB Compounds: (A:) serine carboxypeptidase II, (B:) serine carboxypeptidase II

SCOPe Domain Sequences for d1bcs.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1bcs.1 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat (Triticum vulgare) [TaxId: 4565]}
haadriarlpgqpavdfdmysgyitvdegagrslfyllqeapedaqpaplvlwlnggpgc
ssvaygaseelgafrvkprgaglvlneyrwnkvanvlfldspagvgfsytntssdiytsg
dnrtahdsyaflakwferfphykyrdfyiagesyaghyvpelsqlvhrsknpvinlkgfm
vgngliddyhdyvgtfefwwnhgivsddtyrrlkeaclhdsfihpspacdaatdvataeq
gnidmyslytpvcniXsydpcterystayynrrdvqmalhanvtgamnytwatcsdtint
hwhdaprsmlpiyreliaaglriwvfsgdtdavvpltatrysigalglptttswypwydd
qevggwsqvykgltlvsvrgaghevplhrprqalvlfqyflqgkpmpgq

SCOPe Domain Coordinates for d1bcs.1:

Click to download the PDB-style file with coordinates for d1bcs.1.
(The format of our PDB-style files is described here.)

Timeline for d1bcs.1: