Lineage for d1qfsa2 (1qfs A:431-710)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 248688Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)
    N-terminal domain is a 7-bladed beta-propeller
  6. 248689Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)
  7. 248690Species Pig (Sus scrofa) [TaxId:9823] [53498] (11 PDB entries)
  8. 248701Domain d1qfsa2: 1qfs A:431-710 [34645]
    Other proteins in same PDB: d1qfsa1
    complexed with zpr

Details for d1qfsa2

PDB Entry: 1qfs (more details), 2 Å

PDB Description: prolyl oligopeptidase from porcine muscle with covalently bound inhibitor z-pro-prolinal

SCOP Domain Sequences for d1qfsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfsa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

SCOP Domain Coordinates for d1qfsa2:

Click to download the PDB-style file with coordinates for d1qfsa2.
(The format of our PDB-style files is described here.)

Timeline for d1qfsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfsa1