SCOP 1.59: Domain d1qfsa2: 1qfs A:431-710

Lineage for d1qfsa2 (1qfs A:431-710)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (22 families)

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries)

8. Domain d1qfsa2: 1qfs A:431-710 [34645]
   Other proteins in same PDB: d1qfsa1

Details for d1qfsa2

PDB Entry: 1qfs, 2 Å

PDB Description: prolyl oligopeptidase from porcine muscle with covalently bound inhibitor z-pro-prolinal

SCOP Domain Sequences for d1qfsa2:

Sequence; same for both SEQRES and ATOM records:

>d1qfsa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

Timeline for d1qfsa2:

• d1qfsa2 first appeared (with stable ids) in SCOP 1.55
  
• d1qfsa2 appears in SCOP 1.57
  
• d1qfsa2 appears in SCOP 1.61
  
• d1qfsa2 appears in the current release, SCOPe 2.08