SCOP 1.57: Domain d1e5ta2: 1e5t A:431-710

Lineage for d1e5ta2 (1e5t A:431-710)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families)

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries)

8. Domain d1e5ta2: 1e5t A:431-710 [34644]
   Other proteins in same PDB: d1e5ta1

Details for d1e5ta2

PDB Entry: 1e5t, 1.7 Å

PDB Description: prolyl oligopeptidase from porcine brain, mutant

SCOP Domain Sequences for d1e5ta2:

Sequence; same for both SEQRES and ATOM records:

>d1e5ta2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagmptakvieevsdmfafiarclnidwip

Timeline for d1e5ta2:

• d1e5ta2 first appeared (with stable ids) in SCOP 1.55
  
• d1e5ta2 appears in SCOP 1.59
  
• d1e5ta2 appears in the current release, SCOPe 2.08