Lineage for d1e5ta2 (1e5t A:431-710)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26701Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)
  6. 26702Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)
  7. 26703Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries)
  8. 26707Domain d1e5ta2: 1e5t A:431-710 [34644]
    Other proteins in same PDB: d1e5ta1

Details for d1e5ta2

PDB Entry: 1e5t (more details), 1.7 Å

PDB Description: prolyl oligopeptidase from porcine brain, mutant

SCOP Domain Sequences for d1e5ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ta2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagmptakvieevsdmfafiarclnidwip

SCOP Domain Coordinates for d1e5ta2:

Click to download the PDB-style file with coordinates for d1e5ta2.
(The format of our PDB-style files is described here.)

Timeline for d1e5ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5ta1