Lineage for d1qfma2 (1qfm A:431-710)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73736Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)
  6. 73737Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)
  7. 73738Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries)
  8. 73739Domain d1qfma2: 1qfm A:431-710 [34641]
    Other proteins in same PDB: d1qfma1

Details for d1qfma2

PDB Entry: 1qfm (more details), 1.4 Å

PDB Description: prolyl oligopeptidase from porcine muscle

SCOP Domain Sequences for d1qfma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

SCOP Domain Coordinates for d1qfma2:

Click to download the PDB-style file with coordinates for d1qfma2.
(The format of our PDB-style files is described here.)

Timeline for d1qfma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfma1