Lineage for d1qfma2 (1qfm A:431-710)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein) Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [53498] (5 PDB entries) 
Domain d1qfma2: 1qfm A:431-710 [34641]
Other proteins in same PDB: d1qfma1
Details for d1qfma2
PDB Entry: 1qfm (more details), 1.4 Å
PDB Description: prolyl oligopeptidase from porcine muscle
SCOP Domain Sequences for d1qfma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa)}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip
SCOP Domain Coordinates for d1qfma2:
Click to download the PDB-style file with coordinates for d1qfma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qfma2:
- d1qfma2 appears in SCOP 1.57
- d1qfma2 appears in the current release, SCOPe 2.08
View in 3D
