Lineage for d1dqya_ (1dqy A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491701Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 491702Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 491851Family c.69.1.3: Mycobacterial antigens [53491] (4 proteins)
  6. 491861Protein Antigen 85c [53494] (1 species)
  7. 491862Species Mycobacterium tuberculosis [TaxId:1773] [53495] (3 PDB entries)
  8. 491865Domain d1dqya_: 1dqy A: [34640]

Details for d1dqya_

PDB Entry: 1dqy (more details), 1.83 Å

PDB Description: crystal structure of antigen 85c from mycobacterium tuberculosis with diethyl phosphate inhibitor

SCOP Domain Sequences for d1dqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqya_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpseswwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOP Domain Coordinates for d1dqya_:

Click to download the PDB-style file with coordinates for d1dqya_.
(The format of our PDB-style files is described here.)

Timeline for d1dqya_: