Lineage for d1dqza_ (1dqz A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842159Family c.69.1.3: Mycobacterial antigens [53491] (4 proteins)
  6. 842169Protein Antigen 85c [53494] (1 species)
  7. 842170Species Mycobacterium tuberculosis [TaxId:1773] [53495] (3 PDB entries)
    Uniprot P31953
  8. 842171Domain d1dqza_: 1dqz A: [34638]

Details for d1dqza_

PDB Entry: 1dqz (more details), 1.5 Å

PDB Description: crystal structure of antigen 85c from mycobacterium tuberculosis
PDB Compounds: (A:) protein (antigen 85-c)

SCOP Domain Sequences for d1dqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}
rpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqs
glsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavg
lsmsggsalilaayypqqfpyaaslsgflnpseswwptliglamndsggynansmwgpss
dpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdty
aadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOP Domain Coordinates for d1dqza_:

Click to download the PDB-style file with coordinates for d1dqza_.
(The format of our PDB-style files is described here.)

Timeline for d1dqza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dqzb_