Lineage for d1f0pa_ (1f0p A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26691Family c.69.1.3: Mycobacterial antigens [53491] (2 proteins)
  6. Protein Antigen 85b [53492] (1 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [53493] (2 PDB entries)
  8. Domain d1f0pa_: 1f0p A: [34637]

Details for d1f0pa_

PDB Entry: 1f0p (more details), 1.9 Å

PDB Description: mycobacterium tuberculosis antigen 85b with trehalose

SCOP Domain Sequences for d1f0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0pa_ c.69.1.3 (A:) Antigen 85b {Mycobacterium tuberculosis}
srpglpveylqvpspsmgrdikvqfqsggnnspavylldglraqddyngwdintpafewy
yqsglsivmpvggqssfysdwyspacgkagcqtykwetfltselpqwlsanravkptgsa
aiglsmagssamilaayhpqqfiyagslsalldpsqgmgpsliglamgdaggykaadmwg
pssdpawerndptqqipklvanntrlwvycgngtpnelgganipaeflenfvrssnlkfq
daynaagghnavfnfppngthsweywgaqlnamkgdlqsslgag

SCOP Domain Coordinates for d1f0pa_ are not available.

Timeline for d1f0pa_: