Lineage for d1qe3a_ (1qe3 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26620Family c.69.1.1: Acetylcholinesterase-like [53475] (3 protein domains)
  6. 26679Protein Thermophylic para-nitrobenzyl esterase (PNB esterase) [53485] (1 species)
  7. 26680Species Bacillus subtilis [TaxId:1423] [53486] (3 PDB entries)
  8. 26681Domain d1qe3a_: 1qe3 A: [34630]

Details for d1qe3a_

PDB Entry: 1qe3 (more details), 1.5 Å

PDB Description: pnb esterase

SCOP Domain Sequences for d1qe3a_:

Sequence, based on SEQRES records: (download)

>d1qe3a_ c.69.1.1 (A:) Thermophylic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis}
thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpic
pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
klaaqgevivvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpd
nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
lligttrdegylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdl
lfwrpavayasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakaei
tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq
klf

Sequence, based on observed residues (ATOM records): (download)

>d1qe3a_ c.69.1.1 (A:) Thermophylic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis}
thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpic
pqpslprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgsklaaqgevi
vvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpdnvtvfgesa
ggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlginesqldrlhtv
aaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgiplligttrde
gylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdllfwrpavay
asaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglitdevkqlshtiqsawi
tfaktgnpsteavnwpayheetretvildseitiendpesekrqklf

SCOP Domain Coordinates for d1qe3a_:

Click to download the PDB-style file with coordinates for d1qe3a_.
(The format of our PDB-style files is described here.)

Timeline for d1qe3a_: