Lineage for d1f6wa_ (1f6w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134231Protein Bile-salt activated lipase (cholesterol esterase) [53482] (2 species)
  7. 2134237Species Human (Homo sapiens) [TaxId:9606] [53484] (2 PDB entries)
  8. 2134238Domain d1f6wa_: 1f6w A: [34629]

Details for d1f6wa_

PDB Entry: 1f6w (more details), 2.3 Å

PDB Description: structure of the catalytic domain of human bile salt activated lipase
PDB Compounds: (A:) bile salt activated lipase

SCOPe Domain Sequences for d1f6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6wa_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Human (Homo sapiens) [TaxId: 9606]}
aklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknf
kkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfl
nnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaa
fggdpdnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkv
aekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipddp
inlyanaadidyiagtnnmdghifasidmpainkgnkkvteedfyklvseftitkglrga
kttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfsh
psrmpvypkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmg
dsavpthwepyttensgyleitkkmgsssmkrslrtnflrywtltylalptvt

SCOPe Domain Coordinates for d1f6wa_:

Click to download the PDB-style file with coordinates for d1f6wa_.
(The format of our PDB-style files is described here.)

Timeline for d1f6wa_: