Lineage for d1akna_ (1akn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134231Protein Bile-salt activated lipase (cholesterol esterase) [53482] (2 species)
  7. 2134232Species Cow (Bos taurus) [TaxId:9913] [53483] (3 PDB entries)
  8. 2134234Domain d1akna_: 1akn A: [34626]
    complexed with nag

Details for d1akna_

PDB Entry: 1akn (more details), 2.8 Å

PDB Description: structure of bile-salt activated lipase
PDB Compounds: (A:) bile-salt activated lipase

SCOPe Domain Sequences for d1akna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akna_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]}
aklgsvyteggfvegvnkklslfgdsidifkgipfaaapkalekperhpgwqgtlkaksf
kkrclqatltqdstygnedclylniwvpqgrkevshdlpvmiwiyggaflmgasqganfl
snylydgeeiatrgnvivvtfnyrvgplgflstgdsnlpgnyglwdqhmaiawvkrniea
fggdpdnitlfgesaggasvslqtlspynkglikraisqsgvglcpwaiqqdplfwakri
aekvgcpvddtskmagclkitdpraltlayklplgsteypklhylsfvpvidgdfipddp
vnlyanaadvdyiagtndmdghlfvgmdvpainsnkqdvteedfyklvsgltvtkglrga
natyevytepwaqdssqetrkktmvdletdilfliptkiavaqhkshaksantytylfsq
psrmpiypkwmgadhaddlqyvfgkpfatplgyraqdrtvskamiaywtnfartgdpntg
hstvpanwdpytleddnyleinkqmdsnsmklhlrtnylqfwtqtyqalptvtsagasll
ppednsq

SCOPe Domain Coordinates for d1akna_:

Click to download the PDB-style file with coordinates for d1akna_.
(The format of our PDB-style files is described here.)

Timeline for d1akna_: