Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein Acetylcholinesterase [53476] (5 species) |
Species Electric eel (Electrophorus electricus) [TaxId:8005] [53478] (3 PDB entries) |
Domain d1c2oc_: 1c2o C: [34612] |
PDB Entry: 1c2o (more details), 4.2 Å
SCOPe Domain Sequences for d1c2oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2oc_ c.69.1.1 (C:) Acetylcholinesterase {Electric eel (Electrophorus electricus) [TaxId: 8005]} dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
Timeline for d1c2oc_: