Lineage for d1c2oc_ (1c2o C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134066Species Electric eel (Electrophorus electricus) [TaxId:8005] [53478] (3 PDB entries)
  8. 2134070Domain d1c2oc_: 1c2o C: [34612]

Details for d1c2oc_

PDB Entry: 1c2o (more details), 4.2 Å

PDB Description: electrophorus electricus acetylcholinesterase
PDB Compounds: (C:) acetylcholinesterase

SCOPe Domain Sequences for d1c2oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2oc_ c.69.1.1 (C:) Acetylcholinesterase {Electric eel (Electrophorus electricus) [TaxId: 8005]}
dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOPe Domain Coordinates for d1c2oc_:

Click to download the PDB-style file with coordinates for d1c2oc_.
(The format of our PDB-style files is described here.)

Timeline for d1c2oc_: