Lineage for d1eeaa_ (1eea A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134066Species Electric eel (Electrophorus electricus) [TaxId:8005] [53478] (3 PDB entries)
  8. 2134067Domain d1eeaa_: 1eea A: [34609]

Details for d1eeaa_

PDB Entry: 1eea (more details), 4.5 Å

PDB Description: acetylcholinesterase
PDB Compounds: (A:) protein (acetylcholinesterase)

SCOPe Domain Sequences for d1eeaa_:

Sequence, based on SEQRES records: (download)

>d1eeaa_ c.69.1.1 (A:) Acetylcholinesterase {Electric eel (Electrophorus electricus) [TaxId: 8005]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllna

Sequence, based on observed residues (ATOM records): (download)

>d1eeaa_ c.69.1.1 (A:) Acetylcholinesterase {Electric eel (Electrophorus electricus) [TaxId: 8005]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
eskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllna

SCOPe Domain Coordinates for d1eeaa_:

Click to download the PDB-style file with coordinates for d1eeaa_.
(The format of our PDB-style files is described here.)

Timeline for d1eeaa_: