Lineage for d1qima_ (1qim A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26620Family c.69.1.1: Acetylcholinesterase-like [53475] (3 protein domains)
  6. 26621Protein Acetylcholinesterase [53476] (5 species)
  7. 26629Species Electric ray (Torpedo californica) [53477] (28 PDB entries)
  8. 26654Domain d1qima_: 1qim A: [34605]

Details for d1qima_

PDB Entry: 1qim (more details), 3 Å

PDB Description: specific chemical and structural damage at nine time points (point i) caused by intense synchrotron radiation to torpedo californica acetylcholinesterase

SCOP Domain Sequences for d1qima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qima_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1qima_:

Click to download the PDB-style file with coordinates for d1qima_.
(The format of our PDB-style files is described here.)

Timeline for d1qima_: