Lineage for d6bqec_ (6bqe C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916002Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)
  8. 2916035Domain d6bqec_: 6bqe C: [345886]
    automated match to d3kbra_
    complexed with act

Details for d6bqec_

PDB Entry: 6bqe (more details), 3.2 Å

PDB Description: low-resolution structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa in space group p4322.
PDB Compounds: (C:) Arogenate dehydratase

SCOPe Domain Sequences for d6bqec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bqec_ c.94.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwleyrwptah

SCOPe Domain Coordinates for d6bqec_:

Click to download the PDB-style file with coordinates for d6bqec_.
(The format of our PDB-style files is described here.)

Timeline for d6bqec_: