Lineage for d5xfah_ (5xfa H:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624583Species Hydrogenophilus thermoluteolus [TaxId:297] [346413] (2 PDB entries)
  8. 2624587Domain d5xfah_: 5xfa H: [345882]
    automated match to d5odqf_
    complexed with fco, fes, mg, ni, sf4

Details for d5xfah_

PDB Entry: 5xfa (more details), 2.7 Å

PDB Description: crystal structure of nad+-reducing [nife]-hydrogenase in the h2- reduced state
PDB Compounds: (H:) NAD-reducing hydrogenase

SCOPe Domain Sequences for d5xfah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfah_ e.18.1.0 (H:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]}
natrrvaidplsrveghgkvtiwldddgqvvearlhivefrgfeafivgrpyweapvvvq
rlcgicpvshhlaaakaldrlvgvtqlpptaekmrrlmhygqvlqshalhffylaapdll
lgfsadpaqrnvfglaaqkrelarqgilvrqfgqecieatagkrihgtsavpggihknls
rrermallsrapeirswceaavalierlftehapffaqfgsfqtktfslvaadgsldlyd
gtfrvkeangailidhydpndydqllveavrpwsymkfpylkaygepdgfyrvgpsarli
ncdrlttaraeaarqrfltfdqgtvahstlgyhwarliemlhcaeliealltdadlegge
lrargqrqhrgvgvieaprgtlihhyevgdddlitycnlivstthnnavmnqavttaaka
flsgvtlteallnhievavrafdpclscath

SCOPe Domain Coordinates for d5xfah_:

Click to download the PDB-style file with coordinates for d5xfah_.
(The format of our PDB-style files is described here.)

Timeline for d5xfah_: