Lineage for d1acj__ (1acj -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126362Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 126363Superfamily c.69.1: alpha/beta-Hydrolases [53474] (22 families) (S)
  5. 126364Family c.69.1.1: Acetylcholinesterase-like [53475] (3 proteins)
  6. 126365Protein Acetylcholinesterase [53476] (5 species)
  7. 126373Species Electric ray (Torpedo californica) [53477] (30 PDB entries)
  8. 126394Domain d1acj__: 1acj - [34588]

Details for d1acj__

PDB Entry: 1acj (more details), 2.8 Å

PDB Description: quaternary ligand binding to aromatic residues in the active-site gorge of acetylcholinesterase

SCOP Domain Sequences for d1acj__:

Sequence, based on SEQRES records: (download)

>d1acj__ c.69.1.1 (-) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Sequence, based on observed residues (ATOM records): (download)

>d1acj__ c.69.1.1 (-) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1acj__:

Click to download the PDB-style file with coordinates for d1acj__.
(The format of our PDB-style files is described here.)

Timeline for d1acj__: