Lineage for d5xf9d_ (5xf9 D:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624583Species Hydrogenophilus thermoluteolus [TaxId:297] [346413] (2 PDB entries)
  8. 2624584Domain d5xf9d_: 5xf9 D: [345879]
    automated match to d5odqf_
    complexed with 3ni, fco, fes, fmn, mg, sf4

Details for d5xf9d_

PDB Entry: 5xf9 (more details), 2.58 Å

PDB Description: crystal structure of nad+-reducing [nife]-hydrogenase in the air- oxidized state
PDB Compounds: (D:) NAD-reducing hydrogenase

SCOPe Domain Sequences for d5xf9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xf9d_ e.18.1.0 (D:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]}
slpanatrrvaidplsrveghgkvtiwldddgqvvearlhivefrgfeafivgrpyweap
vvvqrlcgicpvshhlaaakaldrlvgvtqlpptaekmrrlmhygqvlqshalhffylaa
pdlllgfsadpaqrnvfglaaqkrelarqgilvrqfgqecieatagkrihgtsavpggih
knlsrrermallsrapeirswceaavalierlftehapffaqfgsfqtktfslvaadgsl
dlydgtfrvkeangailidhydpndydqllveavrpwsymkfpylkaygepdgfyrvgps
arlincdrlttaraeaarqrfltfdqgtvahstlgyhwarliemlhcaeliealltdadl
eggelrargqrqhrgvgvieaprgtlihhyevgdddlitycnlivstthnnavmnqavtt
aakaflsgvtlteallnhievavrafdpclscath

SCOPe Domain Coordinates for d5xf9d_:

Click to download the PDB-style file with coordinates for d5xf9d_.
(The format of our PDB-style files is described here.)

Timeline for d5xf9d_: