SCOPe 2.08: Domain d5x4bb_: 5x4b B:

Lineage for d5x4bb_ (5x4b B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [256925] (4 PDB entries)

8. Domain d5x4bb_: 5x4b B: [345878]
   automated match to d4kyua_
   complexed with gdp, k, mg, na

Details for d5x4bb_

PDB Entry: 5x4b, 1.5 Å

PDB Description: crystal structure of n-terminal g-domain of enga from bacillus subtilis

PDB Compounds: (B:) GTPase Der

SCOPe Domain Sequences for d5x4bb_:

Sequence, based on SEQRES records:

>d5x4bb_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtggid
igdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkld
ntemraniydfyslgfgepypisgthglglgdlldavaehf

Sequence, based on observed residues (ATOM records):

>d5x4bb_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriaiyssaewlnydfnlidtggidigdepflaqirqqaeia
mdeadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniydfyslgfg
epypisgthglglgdlldavaehf

Timeline for d5x4bb_:

• d5x4bb_ first appeared in SCOPe 2.07