Lineage for d5wyaa_ (5wya A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472659Species Lactobacillus buchneri [TaxId:1581] [316142] (5 PDB entries)
  8. 2472668Domain d5wyaa_: 5wya A: [345873]
    automated match to d5g2ql_
    complexed with 7vo, dms

Details for d5wyaa_

PDB Entry: 5wya (more details), 2.65 Å

PDB Description: structure of amino acid racemase, 2.65 a
PDB Compounds: (A:) Isoleucine 2-epimerase

SCOPe Domain Sequences for d5wyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wyaa_ c.67.1.0 (A:) automated matches {Lactobacillus buchneri [TaxId: 1581]}
kldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasainvght
hekvvkaiadqaqklihytpayfhhvpgmelseklakiapgnspkmvsfgnsgsdandai
ikfaraytgrqyivsymgsyhgstygsqtlsgsslnmtrkigpmlpsvvhvpypdsyrty
pgetehdvslryfnefkkpfesflpadetacvliepiqgdggiikapeeymqlvykfche
hgilfaidevnqglgrtgkmwaiqqfkdiepdlmsvgkslasgmplsavigkkevmqsld
apahlfttagnpvcsaaslatldvieyeglveksatdgayakqrflemqqrhpmigdvrm
wglnggielvkdpktkepdsdaatkviyyafahgvviitlagnilrfqpplvipreqldq
alqvlddaftavengevti

SCOPe Domain Coordinates for d5wyaa_:

Click to download the PDB-style file with coordinates for d5wyaa_.
(The format of our PDB-style files is described here.)

Timeline for d5wyaa_:

  • d5wyaa_ is new in SCOPe 2.07-stable