SCOPe 2.08: Domain d5wccl2: 5wcc L:108-211

Lineage for d5wccl2 (5wcc L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5wccl2: 5wcc L:108-211 [345870]
   Other proteins in same PDB: d5wcca_, d5wccb1, d5wcch_, d5wccl1
   automated match to d2fb4l2
   complexed with 15p, gol, so4

Details for d5wccl2

PDB Entry: 5wcc, 2.46 Å

PDB Description: crystal structure of the broadly neutralizing influenza a antibody vrc 315 02-1f07 fab.

PDB Compounds: (L:) VRC 315 02-1F07 Fab Light chain

SCOPe Domain Sequences for d5wccl2:

Sequence; same for both SEQRES and ATOM records:

>d5wccl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d5wccl2:

• d5wccl2 first appeared in SCOPe 2.07