SCOPe 2.08: Domain d5wccl1: 5wcc L:2-107

Lineage for d5wccl1 (5wcc L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wccl1: 5wcc L:2-107 [345869]
   Other proteins in same PDB: d5wcca_, d5wccb2, d5wcch_, d5wccl2
   automated match to d2mcg11
   complexed with 15p, gol, so4

Details for d5wccl1

PDB Entry: 5wcc, 2.46 Å

PDB Description: crystal structure of the broadly neutralizing influenza a antibody vrc 315 02-1f07 fab.

PDB Compounds: (L:) VRC 315 02-1F07 Fab Light chain

SCOPe Domain Sequences for d5wccl1:

Sequence, based on SEQRES records:

>d5wccl1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgspgqsvtisctgtrsdidgynyvswyqqhpgkapkliisevnkrpsgvp
arfsgsksgnrasltvsglqtedeadyycssytdtnnfyvfgtgtkvtvlg

Sequence, based on observed residues (ATOM records):

>d5wccl1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgspgqsvtisctgtynyvswyqqhpgkapkliisevnkrpsgvparfsgs
ksgnrasltvsglqtedeadyycssytdtnnfyvfgtgtkvtvlg

Timeline for d5wccl1:

• d5wccl1 first appeared in SCOPe 2.07