Lineage for d5wccb1 (5wcc B:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757816Domain d5wccb1: 5wcc B:3-107 [345867]
    Other proteins in same PDB: d5wcca_, d5wccb2, d5wcch_, d5wccl2
    automated match to d2mcg11
    complexed with 15p, gol, so4

Details for d5wccb1

PDB Entry: 5wcc (more details), 2.46 Å

PDB Description: crystal structure of the broadly neutralizing influenza a antibody vrc 315 02-1f07 fab.
PDB Compounds: (B:) VRC 315 02-1F07 Fab Light chain

SCOPe Domain Sequences for d5wccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wccb1 b.1.1.0 (B:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqppsasgspgqsvtisctgtrsdidgynyvswyqqhpgkapkliisevnkrpsgvpa
rfsgsksgnrasltvsglqtedeadyycssytdtnnfyvfgtgtkvtvlg

SCOPe Domain Coordinates for d5wccb1:

Click to download the PDB-style file with coordinates for d5wccb1.
(The format of our PDB-style files is described here.)

Timeline for d5wccb1: