Lineage for d5vegb_ (5veg B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (28 species)
    not a true protein
  7. 2439709Species Lactobacillus reuteri [TaxId:1598] [346282] (1 PDB entry)
  8. 2439711Domain d5vegb_: 5veg B: [345865]
    automated match to d5ljia_
    complexed with cd, fmn, na

Details for d5vegb_

PDB Entry: 5veg (more details), 1.99 Å

PDB Description: structure of a short-chain flavodoxin associated with a non-canonical pdu bacterial microcompartment
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d5vegb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vegb_ c.23.5.0 (B:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
mltahvvyatmtgnneevanivcdsltnlnvkvteseisqtdvadfmkadilvvcaytyd
egampeegldfyddlqstdltgkvygvagsgdkfygeyfnttvdhfddafkkagatsgae
kvkidlepyeedierlnkfaeglvktask

SCOPe Domain Coordinates for d5vegb_:

Click to download the PDB-style file with coordinates for d5vegb_.
(The format of our PDB-style files is described here.)

Timeline for d5vegb_:

  • d5vegb_ is new in SCOPe 2.07-stable