![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5v52d1: 5v52 D:33-158 [345862] Other proteins in same PDB: d5v52c2, d5v52d2 automated match to d5b21a_ complexed with gol, nag, so4 |
PDB Entry: 5v52 (more details), 3.1 Å
SCOPe Domain Sequences for d5v52d1:
Sequence, based on SEQRES records: (download)
>d5v52d1 b.1.1.0 (D:33-158) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvrvqvlpevrgqlggtvelpchllppvpglyislvtwqrpdapanhqnvaafhpkmgps fpspkpgserlsfvsakqstgqdteaelqdatlalhgltvedegnytcefatfpkgsvrg mtwlrv
>d5v52d1 b.1.1.0 (D:33-158) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvrvqvlpevrgqlggtvelpchllppvpglyislvtwqrpdapanhqnvaafhpkmgps fpspkpgserlsfvsakqstteaelqdatlalhgltvedegnytcefatfpkgsvrgmtw lrv
Timeline for d5v52d1:
![]() Domains from other chains: (mouse over for more information) d5v52a_, d5v52b_, d5v52c1, d5v52c2 |