![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.7: Mob1/phocein [101152] (2 families) ![]() common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
![]() | Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
![]() | Protein automated matches [319235] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries) |
![]() | Domain d5twga1: 5twg A:23-211 [345852] automated match to d5twfa_ complexed with zn |
PDB Entry: 5twg (more details), 2.3 Å
SCOPe Domain Sequences for d5twga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5twga1 a.29.7.1 (A:23-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} shqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefctea scpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpk nfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrela plqeliekl
Timeline for d5twga1: