SCOPe 2.07: Domain d5tqvb_: 5tqv B:

Lineage for d5tqvb_ (5tqv B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [226459] (7 PDB entries)

8. Domain d5tqvb_: 5tqv B: [345851]
   automated match to d5tt1a_

Details for d5tqvb_

PDB Entry: 5tqv, 1.65 Å

PDB Description: crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans

PDB Compounds: (B:) NADPH-dependent carbonyl reductase

SCOPe Domain Sequences for d5tqvb_:

Sequence, based on SEQRES records:

>d5tqvb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mktvlivgasrglgrefvrqyqrdgwnviatarddaslaalralgahahalditqpeqia
algwkldgerldvavvvsgvygprtegvetiasddfdtvmhtnvrgpmqllpillplved
argvlavvssrmgsiseatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaqaaldpatsvtgmrrviaeagadvsqsngrffqydgvelsw

Sequence, based on observed residues (ATOM records):

>d5tqvb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mktvlivgasrglgrefvrqyqrdgwnviatarddaslaalralgahahalditqpeqia
algwkldgerldvavvvsgvygprtegvetiasddfdtvmhtnvrgpmqllpillplved
argvlavvssrmgsiseatgttgwlyraskaalndvlriaslqtrhaacislhpgwvral
dpatsvtgmrrviaeagadvsqsngrffqydgvelsw

Timeline for d5tqvb_:

• d5tqvb_ is new in SCOPe 2.07-stable
  
• d5tqvb_ appears in the current release, SCOPe 2.08