Lineage for d5tqvb_ (5tqv B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2430788Species Burkholderia multivorans [TaxId:395019] [226459] (7 PDB entries)
  8. 2430804Domain d5tqvb_: 5tqv B: [345851]
    automated match to d5tt1a_

Details for d5tqvb_

PDB Entry: 5tqv (more details), 1.65 Å

PDB Description: crystal structure of nadp-dependent carbonyl reductase from burkholderia multivorans
PDB Compounds: (B:) NADPH-dependent carbonyl reductase

SCOPe Domain Sequences for d5tqvb_:

Sequence, based on SEQRES records: (download)

>d5tqvb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mktvlivgasrglgrefvrqyqrdgwnviatarddaslaalralgahahalditqpeqia
algwkldgerldvavvvsgvygprtegvetiasddfdtvmhtnvrgpmqllpillplved
argvlavvssrmgsiseatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaqaaldpatsvtgmrrviaeagadvsqsngrffqydgvelsw

Sequence, based on observed residues (ATOM records): (download)

>d5tqvb_ c.2.1.0 (B:) automated matches {Burkholderia multivorans [TaxId: 395019]}
mktvlivgasrglgrefvrqyqrdgwnviatarddaslaalralgahahalditqpeqia
algwkldgerldvavvvsgvygprtegvetiasddfdtvmhtnvrgpmqllpillplved
argvlavvssrmgsiseatgttgwlyraskaalndvlriaslqtrhaacislhpgwvral
dpatsvtgmrrviaeagadvsqsngrffqydgvelsw

SCOPe Domain Coordinates for d5tqvb_:

Click to download the PDB-style file with coordinates for d5tqvb_.
(The format of our PDB-style files is described here.)

Timeline for d5tqvb_:

  • d5tqvb_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5tqva_