| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
| Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
| Protein Methyl-accepting chemotaxis protein PctA [346102] (2 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [346377] (2 PDB entries) |
| Domain d5t7mb_: 5t7m B: [345846] automated match to d5t65a_ complexed with act, na, trp |
PDB Entry: 5t7m (more details), 2.25 Å
SCOPe Domain Sequences for d5t7mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t7mb_ d.110.6.4 (B:) Methyl-accepting chemotaxis protein PctA {Pseudomonas aeruginosa [TaxId: 287]}
nairedlesylremgdvtssniqnwlggrlllveqtaqtlardhspetvsalleqpalts
tfsftylgqqdgvftmrpdspmpagydprsrpwykdavaaggltltepyvdaatqeliit
aatpvkaagntlgvvggdlslktlvqiinsldfsgmgyaflvsgdgkilvhpdkeqvmkt
lsevypqntpkiatgfseaelhghtrilaftpikglpsvtwylalsidkdkayaml
Timeline for d5t7mb_: