![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (16 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [346266] (2 PDB entries) |
![]() | Domain d5t3nb1: 5t3n B:297-439 [345841] Other proteins in same PDB: d5t3na2, d5t3nb2 automated match to d5kjxa_ complexed with 75g, iod |
PDB Entry: 5t3n (more details), 2.4 Å
SCOPe Domain Sequences for d5t3nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t3nb1 b.82.3.0 (B:297-439) automated matches {Plasmodium falciparum [TaxId: 36329]} akkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffilidgn avaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpiedi lhrnvenykkvlnelgldttcid
Timeline for d5t3nb1: