Lineage for d5t3nb1 (5t3n B:297-439)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405808Species Plasmodium falciparum [TaxId:36329] [346266] (2 PDB entries)
  8. 2405812Domain d5t3nb1: 5t3n B:297-439 [345841]
    Other proteins in same PDB: d5t3na2, d5t3nb2
    automated match to d5kjxa_
    complexed with 75g, iod

Details for d5t3nb1

PDB Entry: 5t3n (more details), 2.4 Å

PDB Description: sp-2cl-camps bound to pkar cbd2
PDB Compounds: (B:) cAMP-dependent protein kinase regulatory subunit

SCOPe Domain Sequences for d5t3nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3nb1 b.82.3.0 (B:297-439) automated matches {Plasmodium falciparum [TaxId: 36329]}
akkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffilidgn
avaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpiedi
lhrnvenykkvlnelgldttcid

SCOPe Domain Coordinates for d5t3nb1:

Click to download the PDB-style file with coordinates for d5t3nb1.
(The format of our PDB-style files is described here.)

Timeline for d5t3nb1:

  • d5t3nb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5t3nb2