SCOPe 2.07: Domain d5qcfa1: 5qcf A:1-217

Lineage for d5qcfa1 (5qcf A:1-217)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d5qcfa1: 5qcf A:1-217 [345827]
   Other proteins in same PDB: d5qcfa2
   automated match to d3mpea_
   complexed with bjd, gol, so4

Details for d5qcfa1

PDB Entry: 5qcf, 2.1 Å

PDB Description: crystal structure of human cathepsin-s with bound ligand

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d5qcfa1:

Sequence; same for both SEQRES and ATOM records:

>d5qcfa1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d5qcfa1:

• d5qcfa1 is new in SCOPe 2.07-stable
  
• d5qcfa1 appears in the current release, SCOPe 2.08