Lineage for d5qcda1 (5qcd A:0-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926699Protein (Pro)cathepsin S [82566] (1 species)
  7. 2926700Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2926721Domain d5qcda1: 5qcd A:0-217 [345825]
    Other proteins in same PDB: d5qcda2
    automated match to d3mpea_
    complexed with bhj, so4

Details for d5qcda1

PDB Entry: 5qcd (more details), 1.95 Å

PDB Description: crystal structure of human cathepsin-s with bound ligand
PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d5qcda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qcda1 d.3.1.1 (A:0-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
ilpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d5qcda1:

Click to download the PDB-style file with coordinates for d5qcda1.
(The format of our PDB-style files is described here.)

Timeline for d5qcda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qcda2