![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein (Pro)cathepsin S [82566] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries) |
![]() | Domain d5qcda1: 5qcd A:0-217 [345825] Other proteins in same PDB: d5qcda2 automated match to d3mpea_ complexed with bhj, so4 |
PDB Entry: 5qcd (more details), 1.95 Å
SCOPe Domain Sequences for d5qcda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qcda1 d.3.1.1 (A:0-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} ilpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcste kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey wlvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d5qcda1: