Lineage for d5n95a1 (5n95 A:1-470)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623861Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 2623862Protein automated matches [226844] (11 species)
    not a true protein
  7. 2623869Species Foot-and-mouth disease virus [TaxId:12110] [346409] (2 PDB entries)
  8. 2623871Domain d5n95a1: 5n95 A:1-470 [345807]
    Other proteins in same PDB: d5n95a2
    automated match to d5xe0a_
    complexed with 3po; mutant

Details for d5n95a1

PDB Entry: 5n95 (more details), 2.6 Å

PDB Description: tetragonal structure of mutant v173i of 3d polymerase from foot-and- mouth disease virus
PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d5n95a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n95a1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekiragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

SCOPe Domain Coordinates for d5n95a1:

Click to download the PDB-style file with coordinates for d5n95a1.
(The format of our PDB-style files is described here.)

Timeline for d5n95a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n95a2