![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
![]() | Protein automated matches [226844] (11 species) not a true protein |
![]() | Species Foot-and-mouth disease virus [TaxId:12110] [346409] (2 PDB entries) |
![]() | Domain d5n95a1: 5n95 A:1-470 [345807] Other proteins in same PDB: d5n95a2 automated match to d5xe0a_ complexed with 3po; mutant |
PDB Entry: 5n95 (more details), 2.6 Å
SCOPe Domain Sequences for d5n95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n95a1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus [TaxId: 12110]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekiragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d5n95a1: